DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and Prss29

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:277 Identity:91/277 - (32%)
Similarity:130/277 - (46%) Gaps:54/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ITKGNETVLTEFAWMVLLEYRPHDGQQLRTY----------CAGSLINNRYVVTAAHCVSAATRA 170
            |..|:.....::.|.|          .||.|          |.||:|:.::|:|||||:    |.
Mouse    31 IVGGHSAPQGKWPWQV----------SLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCI----RE 81

  Fly   171 RKGDVS-FRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLARE 234
            |..|.| ||  :|:||      .....|:.|     ::|..:.||..|......:|:||::||..
Mouse    82 RDADPSVFR--IRVGE------AYLYGGKEL-----LSVSRVIIHPDFVHAGLGSDVALLQLAVS 133

  Fly   235 VAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKL---RVTYVEPGLCRRKYA 296
            |...|:::||.|||. .|:..:....: |.|||...|..|.|...:|   :|..::..||...|.
Mouse   134 VQSFPNVKPVKLPSE-SLEVTKKDVCW-VTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYH 196

  Fly   297 SI---------VVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPA 352
            :.         ::|.|. ||| |....|||.|||||||:....|.|.|.|:||:|..|..|.:|.
Mouse   197 NATRHRNRGQKLILKDM-LCA-GNQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPG 259

  Fly   353 VYTNVLSYETWITQNIR 369
            ||..|.|:..||||.::
Mouse   260 VYARVQSFLPWITQQMQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 90/273 (33%)
Tryp_SPc 116..364 CDD:214473 87/270 (32%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 90/273 (33%)
Tryp_SPc 31..271 CDD:214473 87/270 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.