DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and Tpsab1

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:266 Identity:89/266 - (33%)
Similarity:118/266 - (44%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVS---- 176
            |..|.|....::.|.|.|  |.:|...:. :|.||||:.::|:||||||..       ||:    
Mouse    29 IVGGQEAHGNKWPWQVSL--RANDTYWMH-FCGGSLIHPQWVLTAAHCVGP-------DVADPNK 83

  Fly   177 FRVSVR---LGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYS 238
            .||.:|   |..|      |.|          :.|.:|..|..|.......||||::|...|..|
Mouse    84 VRVQLRKQYLYYH------DHL----------MTVSQIITHPDFYIVQDGADIALLKLTNPVNIS 132

  Fly   239 PSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLR---VTYVEPGLCRRKYASIVV 300
            ..:.||.||.  ..:.:.||....|.|||......:.|....|:   |..:|..||..||...::
Mouse   133 DYVHPVPLPP--ASETFPSGTLCWVTGWGNIDNGVNLPPPFPLKEVQVPIIENHLCDLKYHKGLI 195

  Fly   301 LGDS-H------LCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVL 358
            .||: |      ||| |....|||.|||||||:...|..|:..|:||:|..|.....|.:||.|.
Mouse   196 TGDNVHIVRDDMLCA-GNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVT 259

  Fly   359 SYETWI 364
            .|..||
Mouse   260 YYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 89/266 (33%)
Tryp_SPc 116..364 CDD:214473 87/264 (33%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 89/266 (33%)
Tryp_SPc 29..265 CDD:214473 87/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.