DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and proc.2

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001120289.1 Gene:proc.2 / 100145345 XenbaseID:XB-GENE-5882297 Length:681 Species:Xenopus tropicalis


Alignment Length:335 Identity:98/335 - (29%)
Similarity:147/335 - (43%) Gaps:61/335 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PLNSVLAKSNPTDSEMRFIR--ESRCLVSDQSDLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDR 104
            |:|......|...:.:|..|  .|:.:..:...|..|  .|| ||||               || 
 Frog   386 PINKTSLDHNEIGASVRAARTGTSKSVWEENHGLASV--EPD-DYNT---------------PD- 431

  Fly   105 SICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATR 169
                ||:   :|..|....|.:..|.||:......|     :|.||||::|:|::||||.     
 Frog   432 ----GDV---RIVGGMRCELGQCPWQVLIRNNRGFG-----FCGGSLISSRWVLSAAHCF----- 479

  Fly   170 ARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLARE 234
              :..:...|::  |:::|..       |.:.|. :|||.::..|.::....:.:||||:.|...
 Frog   480 --ESQIPHHVTI--GDYDTYR-------RDMDEQ-KIAVLQVFSHPNYLAEFYDHDIALLFLRSP 532

  Fly   235 VAYSPSIRPVCLPST-VGLQNWQSGQAFTVAGWGRTLTSESSPVK---MKLRVTYVEPGLCRRKY 295
            ..:....||:|||:. :|....|.||...|:|||  .|.:..|..   :|:|:..|....|....
 Frog   533 AMFGEYSRPICLPNPGLGKMLTQEGQTGQVSGWG--ATRQFGPYTRFLLKVRLPIVSQETCMAST 595

  Fly   296 ASIVVLGDSHLCAEGRSRG--DSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVL 358
            .:|  |..:..|| |...|  |:|.||||||........|.|.|:||:|..|..:....|||.|.
 Frog   596 ENI--LTGNMFCA-GYKEGVKDACSGDSGGPFAVLFHDTWFLVGVVSWGDGCAEKGKYGVYTRVA 657

  Fly   359 SYETWITQNI 368
            :|..||.:.|
 Frog   658 NYMPWIKETI 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 8/37 (22%)
Tryp_SPc 116..367 CDD:238113 79/256 (31%)
Tryp_SPc 116..364 CDD:214473 77/253 (30%)
proc.2NP_001120289.1 GLA 19..80 CDD:214503
EGF_CA 81..117 CDD:238011
FXa_inhibition 123..160 CDD:373209
Tryp_SPc 436..666 CDD:238113 79/256 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.