DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and zgc:163079

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:278 Identity:77/278 - (27%)
Similarity:117/278 - (42%) Gaps:44/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVS 165
            |....:||......:|..|.......:.|...:..:..:    ..||.|||||..:|:|.|. |.
Zfish    21 LGQSDVCGRAPLNTKIIGGLNATQGSWPWQASINLKATE----EFYCGGSLINKGWVLTTAK-VF 80

  Fly   166 AATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIA--VEEIRIHESFGTRLFWNDIAL 228
            |...|..      :.|.||....       ||   ..|.:|:  |.:|..|.::.:  ..:::||
Zfish    81 ALMPASD------IVVYLGRQTQ-------NG---SNPYEISRTVTKIIKHPNYNS--LDSNLAL 127

  Fly   229 IRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWG---RTLTSES---SPVKMKLRVTYVE 287
            ::|:..|.:|..|:||||.:...:  :..|.|..|.|||   |..|.|.   ..|..::....|.
Zfish   128 LKLSSPVTFSDYIKPVCLAAAGSV--FVDGTASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVN 190

  Fly   288 PGLCRRKYASIVVLGDSHLCA-----EGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGS 347
            ...|...|..|:.  :..|||     :|::   .|.||.||||:.....:|:..|:|..|. ||.
Zfish   191 NFECNAAYGGIIT--NKLLCAGYLNEDGKA---PCAGDVGGPLVIKQGAIWIQSGVVVSGY-CGL 249

  Fly   348 RFWPAVYTNVLSYETWIT 365
            ..:|.:|..|..||.||:
Zfish   250 PGYPTIYVRVSEYEDWIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 74/263 (28%)
Tryp_SPc 116..364 CDD:214473 72/260 (28%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 72/261 (28%)
Tryp_SPc 36..267 CDD:238113 73/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.