DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and LOC100004427

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:285 Identity:76/285 - (26%)
Similarity:114/285 - (40%) Gaps:71/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVS 165
            |....:||......:|..|.......:.|...:.:: ..||   .:|:||||:.|:|:|||.|..
Zfish    21 LGQSDVCGRAPLNTKIVGGLNATEGSWPWQASINFK-STGQ---FFCSGSLISERWVLTAASCFQ 81

  Fly   166 AATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPV-QIAVEEIRIHESFGTRLFWNDIALI 229
               |....|    |.:.||...|:.    .|...:|..| |::|.|              ||||:
Zfish    82 ---RINVSD----VVIYLGRLTTNG----SNPYEIPRTVIQVSVTE--------------DIALV 121

  Fly   230 RLAREVAYSPSIRPVCLPS-----TVGLQNWQSGQAFTVAGWGRT----------LTSESSPVKM 279
            :|:..|.::..||||||.:     ..|.::|       |.|||.|          |....:|:..
Zfish   122 QLSSSVTFTDYIRPVCLAAAGSVFVDGTESW-------VTGWGSTSSTNVILSDMLKEVEAPIVN 179

  Fly   280 KLRVTYVEPGLCRRKYASIVVLGDSHLCA-----EGRSRGDSCDGDSGGPLMAFHEGVWVLGGIV 339
            .:..:.:.         .|..| |:.:||     .|::   .|..|.|.||:......|:..|:|
Zfish   180 NIECSNIN---------GITNL-DNVICAGFVNETGKA---PCWEDFGSPLVTRQGSQWIQSGVV 231

  Fly   340 SFGLNCGSRFWPAVYTNVLSYETWI 364
            .|.. ||...:|.:|..|..||.||
Zfish   232 VFTF-CGQNGFPTLYARVSEYEEWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 73/270 (27%)
Tryp_SPc 116..364 CDD:214473 71/268 (26%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 71/269 (26%)
Tryp_SPc 36..257 CDD:238113 73/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587305
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.