DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:293 Identity:86/293 - (29%)
Similarity:132/293 - (45%) Gaps:56/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 STLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAH 162
            ||.|  ..:||......:|..|.|.....:.|.|.::...:.     ..|.||:|...:|::|||
Zfish    16 STCL--AQVCGRPPLGKRIVGGVEASPGSWPWQVDIQMGSNG-----HVCGGSIIAKNWVLSAAH 73

  Fly   163 C------VSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRL 221
            |      |||.|            :.:|.|       .|||....|.|.. |:.:.|.|.:....
Zfish    74 CFPNPSEVSAYT------------LYMGRH-------LLNGYNQFEKVSY-VQRVVIPEGYTDPQ 118

  Fly   222 FWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQ--SGQAFTVAGWGR-----TLTSESSPVKM 279
            ...|:||::|...|:::..|:|||||    ..::|  ||....|.|||.     :||..::  ..
Zfish   119 GGRDVALVQLRAPVSWTDRIQPVCLP----FADFQFNSGTLCYVTGWGHKQEGVSLTGAAA--LR 177

  Fly   280 KLRVTYVEPGLCRRKY-------ASIVVLGDSHLCAEGRSRG-DSCDGDSGGPLMA-FHEGVWVL 335
            ::.|..::...|:..|       :::.:|.|. :||..:..| |||.|||||||:. ...|.|:.
Zfish   178 EVEVPIIDQSSCQFMYQILSSDSSTVDILSDM-ICAGYKEGGKDSCQGDSGGPLVCPVGNGTWIQ 241

  Fly   336 GGIVSFGLNCGSRFWPAVYTNVLSYETWITQNI 368
            .|:|||||.|..:..|.:|:.|.|:|..|...:
Zfish   242 AGVVSFGLGCAQKNRPGIYSRVSSFEKLIRTTV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 81/272 (30%)
Tryp_SPc 116..364 CDD:214473 80/269 (30%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 81/272 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.