DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4H2 and RBM34

DIOPT Version :10

Sequence 1:NP_651820.1 Gene:eIF4H2 / 43645 FlyBaseID:FBgn0039797 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_055829.2 Gene:RBM34 / 23029 HGNCID:28965 Length:430 Species:Homo sapiens


Alignment Length:139 Identity:34/139 - (24%)
Similarity:55/139 - (39%) Gaps:16/139 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YVGNLPKGLVQGDVMKIFSDF-EVKNVRLIKDRETDEFKGYGYVEFETLAQLKSALNCNG----- 124
            :|||||..:.:..:.|.|.|. .:..||:::|:.|...||:|||.||....:..||..|.     
Human   290 FVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDKMTGIGKGFGYVLFENTDSVHLALKLNNSELMG 354

  Fly   125 ---RIKLDNFSAPLRIDIADHRRQNPGAP-SGVGGAPPAGVGHERGGGVG------RGGSTGAAN 179
               |:.........:...::.|.:|...| .|:........||.:...:|      :....|...
Human   355 RKLRVMRSVNKEKFKQQNSNPRLKNVSKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKK 419

  Fly   180 GNNPYYQRR 188
            ...|..||:
Human   420 SGRPKKQRK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4H2NP_651820.1 RRM_SF 58..144 CDD:473069 23/86 (27%)
RBM34NP_055829.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..153
RRM1_RBM34 185..276 CDD:409828
RRM2_RBM34 288..360 CDD:409829 23/69 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..395 4/29 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..430 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.