DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and BCY1

DIOPT Version :10

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_012231.1 Gene:BCY1 / 854778 SGDID:S000001295 Length:416 Species:Saccharomyces cerevisiae


Alignment Length:152 Identity:33/152 - (21%)
Similarity:56/152 - (36%) Gaps:48/152 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 NKSVDWWAFGILVYEFVAGRSPFAIHNRDVI------LMYSKICI-CDYKMPSYFTSQLRSL--V 273
            |.|....:||.|...:.:.|:...:...|.:      |.:.||.: ..:|....:...|:|:  :
Yeast   239 NSSGPGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLGSSFKKRLMYDDLLKSMPVL 303

  Fly   274 ESLMQVDTSK-----------------RLGNSND-------GSSDVKSHPWFQGV-------DWF 307
            :||...|.:|                 |.|:..:       |:.||....  |||       |:|
Yeast   304 KSLTTYDRAKLADALDTKIYQPGETIIREGDQGENFYLIEYGAVDVSKKG--QGVINKLKDHDYF 366

  Fly   308 G---ILNQEVTAPYQPTISGAE 326
            |   :||.   .|.|.|::..:
Yeast   367 GEVALLND---LPRQATVTATK 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 Protein Kinases, catalytic domain 43..334 CDD:473864 33/152 (22%)
BCY1NP_012231.1 DD_R_ScPKA-like 5..48 CDD:438519
CAP_ED 184..282 CDD:237999 9/42 (21%)
CAP_ED 302..409 CDD:237999 20/89 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.