DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and YPK3

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_009584.1 Gene:YPK3 / 852316 SGDID:S000000232 Length:525 Species:Saccharomyces cerevisiae


Alignment Length:389 Identity:103/389 - (26%)
Similarity:184/389 - (47%) Gaps:75/389 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NLENYITRAVLGNGSFGTVMLVREKSGKNYYAAKMMSKEDLV----------------------- 82
            ||.::....|||.|::|.|:||::.:....||.|.:.|.:::                       
Yeast   124 NLHDFKPVRVLGQGAYGKVLLVKDVNTSKLYAMKQLRKAEILISQTATDSKREDEDKNDGNNNDN 188

  Fly    83 ---RLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRRVRKFNEKH 144
               ..|::.....|:.:|:....|.::.|..|......|||:|..:.|||||.:.:.....:|..
Yeast   189 DDGLSKRLERTFAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGTLDETT 253

  Fly   145 ARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKR------VD-------GR 196
            ..||||:::.||.::|...::||||||||.||:|||::.:||||.:|:      ||       ..
Yeast   254 VSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSANDSAVDEEDPENVNA 318

  Fly   197 TSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYKM 261
            ..::.|||||.||||:..:.|:::.||::.|.|:|:.:.|:.|:...|..||:...:......|:
Yeast   319 LYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYTGSNHKVIINKIQQNKQGPKI 383

  Fly   262 PSYFTSQLRSLVESLMQVDTSKR---------LGNSNDGSSDVK------------SHPWFQGVD 305
            |.|.:..::.::.:|::.:|:||         .|.:|..:...|            .|..|:.:|
Yeast   384 PFYLSEGMKDILNALLKKETAKRWNVDKYWAKTGANNKPTKSKKKKSGAARTSLFTEHFIFRKID 448

  Fly   306 W----FGILNQEVTAPYQPTISGAEDLSNFE----NFEFKDRYK-------SRINRHPELFANF 354
            |    .|.|.:....|..|.|:..|...||:    :..:::.|.       :.:::.|::|..|
Yeast   449 WKLLESGQLQKTTLGPIVPVITDLELAENFDTEFTSMSYEETYTDSKPININSVSKSPDMFKGF 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 97/358 (27%)
YPK3NP_009584.1 STKc_AGC 134..406 CDD:270693 79/271 (29%)
S_TK_X 445..516 CDD:214529 14/68 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.