DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and PRKX

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_005035.1 Gene:PRKX / 5613 HGNCID:9441 Length:358 Species:Homo sapiens


Alignment Length:321 Identity:141/321 - (43%)
Similarity:206/321 - (64%) Gaps:4/321 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QSPYTNLENYITRAVLGNGSFGTVMLVREKSGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAA 100
            :.|..:|:::.|.|.:|.|:||.|.||:||:.|:::|.|:||..|::||||..||||||.||...
Human    40 EPPVYSLQDFDTLATVGTGTFGRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEV 104

  Fly   101 RFPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRRVRKFNEKHARFYAAQVALALEYMHKMHLM 165
            ..||||.|..:.....:||:::..|.|||||||.|...:|:.....||:|::..|:||:|...::
Human   105 SHPFLIRLFWTWHDERFLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIV 169

  Fly   166 YRDLKPENILLDQRGYIKITDFGFTKRVDGRTSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILV 230
            ||||||||||||:.|:||:|||||.|::..||.||||||||||||::|.:.:.::|||||.|||:
Human   170 YRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILI 234

  Fly   231 YEFVAGRSPFAIHNRDVILMYSKICICDYKMPSYFTSQLRSLVESLMQVDTSKRLGNSNDGSSDV 295
            :|.::|..||...|...|  |.||.......|.:....::.|::.|:.||.::||||..:|::||
Human   235 FEMLSGFPPFFDDNPFGI--YQKILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDV 297

  Fly   296 KSHPWFQGVDWFGILNQEVTAPYQPTISGAEDLSNFENFEFKDRYKSR--INRHPELFANF 354
            |.|.||:.|||..:..:::..|..|.|:|..|.||||.:...|...:.  ..:..|:|.||
Human   298 KHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 134/290 (46%)
PRKXNP_005035.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
PTZ00263 39..358 CDD:140289 139/319 (44%)
STKc_PRKX_like 47..338 CDD:270763 134/292 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.