DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and PRKG2

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_016863902.1 Gene:PRKG2 / 5593 HGNCID:9416 Length:774 Species:Homo sapiens


Alignment Length:328 Identity:117/328 - (35%)
Similarity:182/328 - (55%) Gaps:35/328 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NMSREFEER--------W------------------NHQTQSPYTNLENYITRAVLGNGSFGTVM 60
            |::|:.|:|        |                  ...:.||:.|||   ..|.||.|.||.|.
Human   407 NLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLE---IIATLGVGGFGRVE 468

  Fly    61 LVREKSGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLV 125
            ||:.|:....:|.|.:.|:.:|..||..||::||.:|.....||::.|..:.|...|:|::|...
Human   469 LVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEAC 533

  Fly   126 NGGELFSYHRRVRKFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFT 190
            .||||:|..|....|:|..::|..|.|..|.:|:|::.::||||||||::||..||:|:.||||.
Human   534 LGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFA 598

  Fly   191 KRVDG--RTSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSK 253
            |::..  :|.|.||||||:|||::..:.::.|||:|:.||||||.:.|..||:  ..|.::.|:.
Human   599 KKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFS--GVDQMMTYNL 661

  Fly   254 ICICDYKM--PSYFTSQLRSLVESLMQVDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTA 316
            |.....||  |...|.:...|:..|.:.:.::||||..:|.:|:|.|.|..|.:|.|:..:.:.:
Human   662 ILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPS 726

  Fly   317 PYQ 319
            |.|
Human   727 PLQ 729

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 108/281 (38%)
PRKG2XP_016863902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.