DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and PRKACB

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_891993.1 Gene:PRKACB / 5567 HGNCID:9381 Length:398 Species:Homo sapiens


Alignment Length:353 Identity:164/353 - (46%)
Similarity:232/353 - (65%) Gaps:7/353 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQHTSQYVFNSKEDYNVILDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVMLVREKS 66
            |:||:.:..:.||    .|.....:|.::|.:.||: ...||::..:..||.||||.||||:.|:
Human    53 SEHTALWDRSMKE----FLAKAKEDFLKKWENPTQN-NAGLEDFERKKTLGTGSFGRVMLVKHKA 112

  Fly    67 GKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELF 131
            .:.|||.|::.|:.:|:|||:.|..|||.:|.|..||||:.|..:.|....||:::..|.|||:|
Human   113 TEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMF 177

  Fly   132 SYHRRVRKFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKRVDGR 196
            |:.||:.:|:|.||||||||:.|..||:|.:.|:||||||||:|:|.:|||::|||||.|||.||
Human   178 SHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGR 242

  Fly   197 TSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYKM 261
            |.|||||||||||||:..:.|||:|||||.|:|:||..||..||...  ..|.:|.||.....:.
Human   243 TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD--QPIQIYEKIVSGKVRF 305

  Fly   262 PSYFTSQLRSLVESLMQVDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAE 326
            ||:|:|.|:.|:.:|:|||.:||.||..:|.||:|:|.||...||..|..::|.||:.|...|:.
Human   306 PSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSG 370

  Fly   327 DLSNFENFEFKDRYKSRINRHPELFANF 354
            |.|||:::|.:|...|...:..:.|..|
Human   371 DTSNFDDYEEEDIRVSITEKCAKEFGEF 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 148/290 (51%)
PRKACBNP_891993.1 STKc_PKA 89..378 CDD:271111 148/290 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142891
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.