DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and PRKACA

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001291278.1 Gene:PRKACA / 5566 HGNCID:9380 Length:427 Species:Homo sapiens


Alignment Length:333 Identity:157/333 - (47%)
Similarity:224/333 - (67%) Gaps:7/333 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YNVILDNMSR---EFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVMLVREKSGKNYYAAKMMS 77
            :||:.:.:::   :|.::|....|:. .:|:.:.....||.||||.||||:.|...|:||.|::.
Human    89 WNVVKEFLAKAKEDFLKKWESPAQNT-AHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILD 152

  Fly    78 KEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRRVRKFNE 142
            |:.:|:|||:.|..|||.:|.|..||||:.|..|.|....||:::..|.|||:||:.||:.:|:|
Human   153 KQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSE 217

  Fly   143 KHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKRVDGRTSTLCGTPEYL 207
            .||||||||:.|..||:|.:.|:||||||||:|:||:|||::|||||.|||.|||.|||||||||
Human   218 PHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYL 282

  Fly   208 APEIVQLRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYKMPSYFTSQLRSL 272
            ||||:..:.|||:|||||.|:|:||..||..||...  ..|.:|.||.....:.||:|:|.|:.|
Human   283 APEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD--QPIQIYEKIVSGKVRFPSHFSSDLKDL 345

  Fly   273 VESLMQVDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAEDLSNFENFEFK 337
            :.:|:|||.:||.||..:|.:|:|:|.||...||..|..::|.||:.|...|..|.|||:::| :
Human   346 LRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYE-E 409

  Fly   338 DRYKSRIN 345
            :..:..||
Human   410 EEIRVSIN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 148/290 (51%)
PRKACANP_001291278.1 STKc_PKA 118..407 CDD:271111 148/290 (51%)
S_TKc 120..374 CDD:214567 134/255 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142886
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S234
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.