DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and Prkx

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001029135.1 Gene:Prkx / 501563 RGDID:1564076 Length:358 Species:Rattus norvegicus


Alignment Length:337 Identity:144/337 - (42%)
Similarity:209/337 - (62%) Gaps:13/337 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVMLVREKSGKNYYAAKMMSKEDLVRLK 85
            |.:.|...::..|       :|:::.|.|.:|.|:||.|.||:||:|:.|.|.|:||..|::|||
  Rat    32 DPLPRTSSQKEGH-------SLQDWDTIATVGTGTFGRVNLVKEKTGRRYCALKIMSIPDVIRLK 89

  Fly    86 QVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRRVRKFNEKHARFYAA 150
            |..||.|||.||.....||||.|:.:.....:||:::..|.|||||:|.|...:|:...|.|||.
  Rat    90 QEQHVQNEKAVLKEINHPFLIKLLWTDHDNRFLYMLMEFVPGGELFTYLRNRGRFSSVAAIFYAT 154

  Fly   151 QVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKRVDGRTSTLCGTPEYLAPEIVQLR 215
            ::..|:||:|...::||||||||||||:.|:||:|||||.|::..||.||||||||||||::|.:
  Rat   155 EIVCAIEYLHSKEIVYRDLKPENILLDREGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSK 219

  Fly   216 PYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYKMPSYFTSQLRSLVESLMQVD 280
            .:.::|||||.|||::|.::|..||...|...|  |.||..|....|.......:.|::.|:.||
  Rat   220 GHGRAVDWWALGILIFEMLSGFPPFFDDNPFGI--YQKILACKIDFPRQLDFTSKDLIKKLLVVD 282

  Fly   281 TSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAEDLSNFENF---EFKDRYKS 342
            .::||||..:|:.|:|.|.||:||:|..:..:::..|..|.:|...|:||||.:   |. |:..|
  Rat   283 RTRRLGNMKNGAEDIKRHRWFRGVEWESVPQRKLKPPIVPKLSSDGDISNFETYPEGEL-DKTPS 346

  Fly   343 RINRHPELFANF 354
            ..:...|.|.||
  Rat   347 VSDEDLETFKNF 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 133/290 (46%)
PrkxNP_001029135.1 PTZ00263 35..358 CDD:140289 141/332 (42%)
STKc_PRKX_like 47..338 CDD:270763 133/292 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.