DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and prkacba

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_957317.1 Gene:prkacba / 393998 ZFINID:ZDB-GENE-040426-1351 Length:395 Species:Danio rerio


Alignment Length:335 Identity:155/335 - (46%)
Similarity:217/335 - (64%) Gaps:7/335 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQHTSQYVFNSKEDYNVILDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVMLVREK 65
            :|:||..:....||    .|.....:|..:|..|.:|. ..|:::.....||.||||.||||:.|
Zfish    49 VSEHTVLWDTAMKE----TLAKAKEDFLNKWECQQKST-ACLDDFDKLKTLGTGSFGRVMLVKHK 108

  Fly    66 SGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGEL 130
            ..:.|:|.|::.|..:|:|||:.|..|||.:|.|..||||:.|..:.|....||:::..:.|||:
Zfish   109 QSEQYFAMKILDKLKVVKLKQIEHTLNEKKILQAVSFPFLVKLECAFKDNSNLYMVMRYIQGGEM 173

  Fly   131 FSYHRRVRKFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKRVDG 195
            ||:.||:.:|:|::|||||||:.|..||:|.:.|:||||||||:|:|.:|||::|||||.|||.|
Zfish   174 FSHLRRIGRFSEQNARFYAAQIVLTFEYLHMLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG 238

  Fly   196 RTSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYK 260
            ||.|||||||||||||:..:.|||:|||||.|:|:||..||..||...  ..|.:|.||.....:
Zfish   239 RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD--QPIQIYEKIVSGKVR 301

  Fly   261 MPSYFTSQLRSLVESLMQVDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGA 325
            .||:|:|.|:.|:.:|:|||.:||.||..:|.||:|:|.||...||..|..::|.||..|...|.
Zfish   302 YPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKNHRWFASTDWIAIYEKKVDAPIIPKCRGP 366

  Fly   326 EDLSNFENFE 335
            .|.|||:.::
Zfish   367 GDTSNFDEYD 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 144/290 (50%)
prkacbaNP_957317.1 PTZ00426 68..379 CDD:173616 149/312 (48%)
STKc_PKA 86..375 CDD:271111 144/290 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575733
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.