DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and Pkg21D

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster


Alignment Length:322 Identity:112/322 - (34%)
Similarity:179/322 - (55%) Gaps:14/322 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QTQSPYTNLENYITRAVLGNGSFGTVMLVR--EKSGKNYYAAKMMSKEDLVRLKQVAHVHNEKHV 96
            |.:.|...|.:....:.||.|.||.|.||:  .:...:.:|.|.:.|..:|..||..|:.:|:|:
  Fly   446 QQEFPDLKLTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIVDTKQEEHIFSERHI 510

  Fly    97 LNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRRVRKFNEKHARFYAAQVALALEYMHK 161
            :.::|.||:..|..:.:...|:|::|....|||:::..|....|.:..|:|....|..|.||:|.
  Fly   511 MLSSRSPFICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHA 575

  Fly   162 MHLMYRDLKPENILLDQRGYIKITDFGFTKRV--DGRTSTLCGTPEYLAPEIVQLRPYNKSVDWW 224
            ..::||||||||::||:|||:||.||||.|::  ..:|.|.||||||:||||:..:.::::||:|
  Fly   576 RGIIYRDLKPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYW 640

  Fly   225 AFGILVYEFVAGRSPFAIHNRDVILMYSKIC--ICDYKMPSYFTSQLRSLVESLMQVDTSKRLGN 287
            |.|||::|.:.|..||:.  .|.:..|:.|.  |.....|.:.:.....|::.|.:...|:|||.
  Fly   641 ALGILIHELLNGTPPFSA--PDPMQTYNLILKGIDMIAFPKHISRWAVQLIKRLCRDVPSERLGY 703

  Fly   288 SNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAEDLSNFENFEFKDRYKSRINRHPE 349
            ...|..|:|.|.||.|.||.|:.:|.:..|:...|:...|:..|      ||:...:|..|:
  Fly   704 QTGGIQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYF------DRFPCDLNEPPD 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 105/296 (35%)
Pkg21DNP_477213.1 Crp 183..386 CDD:223736
CAP_ED 185..285 CDD:237999
CAP_ED 304..419 CDD:237999
Pkinase 457..717 CDD:278497 94/261 (36%)
STKc_cGK 463..724 CDD:270724 99/262 (38%)
S_TK_X 719..>760 CDD:214529 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.