DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and Prkacb

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_006233513.1 Gene:Prkacb / 293508 RGDID:1310574 Length:398 Species:Rattus norvegicus


Alignment Length:334 Identity:160/334 - (47%)
Similarity:221/334 - (66%) Gaps:7/334 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQHTSQYVFNSKEDYNVILDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVMLVREKS 66
            |:||:.:....||    .|.....:|..:|.:...| ...||::..:..||.||||.||||:.|:
  Rat    53 SEHTASWDKPMKE----FLAKAKEDFLRKWENPPPS-NAGLEDFERKKTLGTGSFGRVMLVKHKA 112

  Fly    67 GKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELF 131
            .:.|||.|::.|:.:|:|||:.|..|||.:|.|..||||:.|..|.|....||:::..|.|||:|
  Rat   113 TEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMF 177

  Fly   132 SYHRRVRKFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKRVDGR 196
            |:.||:.:|:|.||||||||:.|..||:|.:.|:||||||||:|:|.:|||::|||||.|||.||
  Rat   178 SHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGR 242

  Fly   197 TSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYKM 261
            |.|||||||||||||:..:.|||:|||||.|:|:||..||..||...  ..|.:|.||.....:.
  Rat   243 TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD--QPIQIYEKIVSGKVRF 305

  Fly   262 PSYFTSQLRSLVESLMQVDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAE 326
            ||:|:|.|:.|:.:|:|||.:||.||..:|.||:|:|.||...||..|..::|.||:.|...|:.
  Rat   306 PSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSG 370

  Fly   327 DLSNFENFE 335
            |.|||:::|
  Rat   371 DTSNFDDYE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 149/290 (51%)
PrkacbXP_006233513.1 PTZ00263 79..398 CDD:140289 152/304 (50%)
STKc_PKA 89..378 CDD:271111 149/290 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336595
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24353
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.