DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and Prkg2

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_037144.1 Gene:Prkg2 / 25523 RGDID:3401 Length:762 Species:Rattus norvegicus


Alignment Length:302 Identity:116/302 - (38%)
Similarity:180/302 - (59%) Gaps:9/302 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SPYTNLENYITRAVLGNGSFGTVMLVREKSGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAAR 101
            ||:.|||   ..|.||.|.||.|.||:.|:....:|.|.:.|:.:|..||..||::||.:|....
  Rat   448 SPFQNLE---IIATLGVGGFGRVELVKVKNENIAFAMKCIRKKHIVDTKQQEHVYSEKRILEELC 509

  Fly   102 FPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRRVRKFNEKHARFYAAQVALALEYMHKMHLMY 166
            .||::.|..:.|...|:|::|....||||:|..|....|:|..::|..|.|..|.:|:|::.::|
  Rat   510 SPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIY 574

  Fly   167 RDLKPENILLDQRGYIKITDFGFTKRVDG--RTSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGIL 229
            |||||||::||..||:|:.||||.|::..  :|.|.||||||:|||::..:.::.|||:|:.|||
  Rat   575 RDLKPENLILDADGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGIL 639

  Fly   230 VYEFVAGRSPFAIHNRDVILMYSKICICDYKM--PSYFTSQLRSLVESLMQVDTSKRLGNSNDGS 292
            |||.:.|..||:  ..|.::.|:.|.....||  |...|.:...|:..|.:.:.::||||..:|.
  Rat   640 VYELLTGNPPFS--GIDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGI 702

  Fly   293 SDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAEDLSNFENF 334
            :|:|.|.|..|.:|.|:..:.:.:|.:..:||..|.|.|:.:
  Rat   703 NDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKY 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 112/294 (38%)
Prkg2NP_037144.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..138
Crp 162..>285 CDD:223736
cGMP-binding, high affinity, cAMP-binding, moderate affinity. /evidence=ECO:0000250|UniProtKB:Q13237 168..283
CAP_ED 168..273 CDD:237999
cGMP-binding, high affinity, cAMP-binding, low affinity. /evidence=ECO:0000250|UniProtKB:Q13237 286..416
CAP_ED 286..401 CDD:237999
PTZ00263 417..752 CDD:140289 116/302 (38%)
STKc_cGK 459..718 CDD:270724 103/260 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 740..762 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.