DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and pka1

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_595159.1 Gene:pka1 / 2539781 PomBaseID:SPBC106.10 Length:512 Species:Schizosaccharomyces pombe


Alignment Length:318 Identity:132/318 - (41%)
Similarity:198/318 - (62%) Gaps:6/318 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ILDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVMLVREKSGKNYYAAKMMSKEDLVR 83
            :||...|..... :|.|:..| .::::.....||.||||.|.||:....:.|||.|::.|:.:|.
pombe   177 LLDLQRRRIRPA-DHTTKDRY-GIQDFNFLQTLGTGSFGRVHLVQSNHNRLYYAIKVLEKKKIVD 239

  Fly    84 LKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRRVRKFNEKHARFY 148
            :||:.|..:|:::|:..:.||:..|..:.:....|::::....||||||..|:..:|.||.|:||
pombe   240 MKQIEHTCDERYILSRVQHPFITILWGTFQDAKNLFMVMDFAEGGELFSLLRKCHRFPEKVAKFY 304

  Fly   149 AAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKRVD-GRTSTLCGTPEYLAPEIV 212
            ||:|.|||:|:|...::||||||||:|||:.|::||.||||.|||. ....||||||:||||||:
pombe   305 AAEVILALDYLHHNQIVYRDLKPENLLLDRFGHLKIVDFGFAKRVSTSNCCTLCGTPDYLAPEII 369

  Fly   213 QLRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYKMPSYFTSQLRSLVESLM 277
            .|:||||:.|||:.|||::|.:||..||  ::.:.:.:|..|.......||||:.....|:..|:
pombe   370 SLKPYNKAADWWSLGILIFEMLAGYPPF--YSENPMKLYENILEGKVNYPSYFSPASIDLLSHLL 432

  Fly   278 QVDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTI-SGAEDLSNFENF 334
            |.|.:.|.||..|||.|:..||||:.:.|..||.:::..||.|.| :|..|.|.|:.:
pombe   433 QRDITCRYGNLKDGSMDIIMHPWFRDISWDKILTRKIEVPYVPPIQAGMGDSSQFDAY 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 126/292 (43%)
pka1NP_595159.1 STKc_PKA_like 199..490 CDD:270732 126/292 (43%)
S_TKc 201..456 CDD:214567 113/256 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.