DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and Prkx

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_058675.1 Gene:Prkx / 19108 MGIID:1309999 Length:355 Species:Mus musculus


Alignment Length:321 Identity:140/321 - (43%)
Similarity:205/321 - (63%) Gaps:14/321 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NLENYITRAVLGNGSFGTVMLVREKSGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFL 105
            :|:::.|.|.:|.|:||.|.||:||:|:.|.|.|:||..|::||||..||.|||.||.....|||
Mouse    42 SLQDWDTIATVGTGTFGRVNLVKEKTGRQYCALKIMSIPDVIRLKQEQHVQNEKAVLKEINHPFL 106

  Fly   106 IYLVDSTKCFDYLYLILPLVNGGELFSYHRRVRKFNEKHARFYAAQVALALEYMHKMHLMYRDLK 170
            |.|:.:.....:||:::..|.|||||:|.|...:|:...:.|||.::..|:||:|...::|||||
Mouse   107 IKLLWTGHDNRFLYMLMEFVPGGELFTYLRNRGRFSSVASVFYATEIVCAIEYLHSKEIVYRDLK 171

  Fly   171 PENILLDQRGYIKITDFGFTKRVDGRTSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVA 235
            |||||||:.|:||:|||||.|::..||.||||||||||||::|.:.:.::|||||.|||::|.::
Mouse   172 PENILLDREGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLS 236

  Fly   236 GRSPFAIHNRDVILMYSKICICDYKMPSYFTSQLRSLVESLMQVDTSKRLGNSNDGSSDVKSHPW 300
            |..||...|...|  |.||..|....|.......:.|::.|:.||.::||||..:|:.|:|.|.|
Mouse   237 GFPPFFDDNPFGI--YQKILACKIDFPRQLDFTSKDLIKKLLVVDRTRRLGNMKNGAEDIKRHRW 299

  Fly   301 FQGVDWFGILNQEVTAPYQPTISGAEDLSNFENFEFKDRYKSRINRHP-------ELFANF 354
            |:||:|..:..:::..|..|.:||..|:||||.:.     :|.:::.|       |.|.||
Mouse   300 FRGVEWESVPQRKLKPPIVPKLSGDGDISNFETYP-----ESELDKTPSVSDKDLETFKNF 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 133/290 (46%)
PrkxNP_058675.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 140/321 (44%)
PTZ00263 31..355 CDD:140289 138/319 (43%)
STKc_PRKX_like 44..335 CDD:270763 133/297 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..355 13/43 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.