DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and LOC101732362

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_004918050.3 Gene:LOC101732362 / 101732362 -ID:- Length:292 Species:Xenopus tropicalis


Alignment Length:276 Identity:86/276 - (31%)
Similarity:146/276 - (52%) Gaps:31/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VHNEKHVL---NAARFPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRRVRKFNEKHARFYAAQ 151
            |..||.:|   .:|..|||:.|..:.:..::|:.::..:.||:|.........|.|..|.||.|.
 Frog    16 VFKEKRILQKVTSAEHPFLVSLYATFQSENHLFFVMKYLPGGDLCHLLEHQGAFEESKAMFYTAC 80

  Fly   152 VALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTK---RVDGRTSTLCGTPEYLAPEIVQ 213
            :.|.||.:|:.::::||||.||:::|..||:||.|||.:|   |...|:.|.|||..|:||||:.
 Frog    81 IVLGLEELHRNNIVHRDLKLENLMVDVHGYLKIVDFGLSKDGFRYGDRSKTRCGTNCYMAPEIID 145

  Fly   214 LRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYKMPSYFTSQLRSLVESLMQ 278
            ...|:::|||||.|:::|..:..:.||  ...|.:.::..|......:....:.:.:.|:..|::
 Frog   146 EMAYSRAVDWWALGVVLYVMIMFQFPF--DAEDDMELFESIRNDKPALTEELSEEAQCLILRLLE 208

  Fly   279 VDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISG------------------A 325
            .:...|||:|..|:.:||:|.:|:.:||...|.:|...|::|.:||                  |
 Frog   209 KNPCHRLGSSEAGAEEVKAHEFFEDIDWEEFLEREQMPPFKPDVSGLTESTRQSECQAWGLMPPA 273

  Fly   326 EDLSN-----FENFEF 336
            |.:|.     ||.|::
 Frog   274 EAISPEAQELFEGFDY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 85/272 (31%)
LOC101732362XP_004918050.3 PKc_like 15..292 CDD:419665 86/276 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.