DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C2 and prkacb

DIOPT Version :9

Sequence 1:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_031755570.1 Gene:prkacb / 100038053 XenbaseID:XB-GENE-482702 Length:396 Species:Xenopus tropicalis


Alignment Length:348 Identity:161/348 - (46%)
Similarity:226/348 - (64%) Gaps:14/348 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QYVFNSKEDYNVILDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVMLVREKSGKNYY 71
            :::..:|||           |..:|....|:. .:|:::.....||.||||.||||:.|..:.||
 Frog    63 EFLAKAKED-----------FLRKWETPPQNT-ASLDDFERIKTLGTGSFGRVMLVKHKGAEQYY 115

  Fly    72 AAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHRR 136
            |.|::.|:.:|:|||:.|..|||.:|.|..||||:.|..|.|....||:::..|.|||:||:.||
 Frog   116 AMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRR 180

  Fly   137 VRKFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKRVDGRTSTLC 201
            :.:|:|.||||||||:.|..||:|.:.|:||||||||:|:||:|||::|||||.|||.|||.|||
 Frog   181 IGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLC 245

  Fly   202 GTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYKMPSYFT 266
            ||||||||||:..:.|||:|||||.|:|:||..||..||...  ..|.:|.||.....:.||:|:
 Frog   246 GTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD--QPIQIYEKIVSGKVRFPSHFS 308

  Fly   267 SQLRSLVESLMQVDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAEDLSNF 331
            |.|:.|:.:|:|||.:||.||..:|.:|:|:|.||...||..|..::|.||:.|...|..|.|||
 Frog   309 SDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKCRGPGDTSNF 373

  Fly   332 ENFEFKDRYKSRINRHPELFANF 354
            :::|.:|...|...:..:.||:|
 Frog   374 DDYEEEDIRVSLTEKCAKEFADF 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 148/290 (51%)
prkacbXP_031755570.1 STKc_PKA 87..376 CDD:271111 148/290 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.