DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12069 and TPK3

DIOPT Version :9

Sequence 1:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_012755.1 Gene:TPK3 / 853688 SGDID:S000001649 Length:398 Species:Saccharomyces cerevisiae


Alignment Length:297 Identity:138/297 - (46%)
Similarity:198/297 - (66%) Gaps:3/297 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LDDYEIKATLGSGSFGKVQLVRERESGVYYASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNTV 108
            |.|::|..|||:||||:|.|:|...:|.:||.|.|.|..|||.|||.|...|:.:|..::.|..:
Yeast    85 LSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFII 149

  Fly   109 NLIASYKDFDSLYLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKP 173
            .:..:::|...:::|:..|.|||||:..||.::|....|:||||:|.|||||||...::||||||
Yeast   150 RMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKP 214

  Fly   174 ENIMMDKNGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAG 238
            |||::||||::|:|||||||.|...|.||||||:|:.||::.:|||..|||||:||||::|.:||
Yeast   215 ENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAG 279

  Fly   239 HSPFSAHNRDVMSMYNKICEADYKMPSYFSGALRHLVDHLLQVDLSKRFGNLINGNRDIKEHEWF 303
            ::||  :|.:.|..|..|..|:.|.|.:|....:.|:..|:..|||:|.|||.||:.|:|.|.||
Yeast   280 YTPF--YNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWF 342

  Fly   304 KDVEWIPLLNQTVNAPYVPNISNPE-DISNFDKVSDK 339
            .:|.|..||.:.:..||.|.|...: |.|.||:..::
Yeast   343 NEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 138/297 (46%)
PKc_like 45..335 CDD:304357 136/290 (47%)
TPK3NP_012755.1 STKc_PKA_like 86..376 CDD:270732 137/291 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341943
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.