DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12069 and AT3G23310

DIOPT Version :9

Sequence 1:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_188973.2 Gene:AT3G23310 / 821911 AraportID:AT3G23310 Length:568 Species:Arabidopsis thaliana


Alignment Length:353 Identity:108/353 - (30%)
Similarity:184/353 - (52%) Gaps:59/353 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GLDDYEIKATLGSGSFGKVQLVRERESGVYYASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNT 107
            |.||:|....:|.|:||:|::.||:.:|..||.|:|.|.::::..||.||.:|:|:|..:.....
plant   116 GTDDFEPLTMIGKGAFGEVRICREKTTGNVYAMKKLKKSEMLRRGQVEHVKAERNLLAEVDSNCI 180

  Fly   108 VNLIASYKDFDSLYLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLK 172
            |.|..|::|.:.|||::..:.||::.|...:....||.:||||..:..||:|.:|..:.::||:|
plant   181 VKLYCSFQDEEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYVGETVLAIESIHKHNYIHRDIK 245

  Fly   173 PENIMMDKNGYLKVTDFGFAKKVE------------------------------TRTM------- 200
            |:|:::|::|::|::|||..|.::                              ||:.       
plant   246 PDNLLLDRSGHMKLSDFGLCKPLDCSILQEKDFVVAHNLSGALQSDGRPVAPRRTRSQMEQLQNW 310

  Fly   201 ---------TLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKI 256
                     :..|||:|:.||::..|.||...|||:.|.:::|.:.|..||  ::.:.|:...||
plant   311 QRNRRMLAYSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGFPPF--YSDEPMTTCRKI 373

  Fly   257 CE-ADY-KMPS--YFSGALRHLVDHLLQVDLSKRFGNLINGNRDIKEHEWFKDVEWIPLLNQTVN 317
            .. .:| |.|.  ..|...:.|:..|| .::.:|.|.  .|..:||||.||..|||..|..  :.
plant   374 VNWKNYLKFPDEVRLSPEAKDLICRLL-CNVEQRIGT--KGANEIKEHPWFSGVEWEKLYQ--MK 433

  Fly   318 APYVPNISNPEDISNFDKV--SDKPRPK 343
            |.::|.:::..|..||:|.  :||..||
plant   434 AAFIPQVNDELDTQNFEKFEETDKQVPK 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 107/352 (30%)
PKc_like 45..335 CDD:304357 102/339 (30%)
AT3G23310NP_188973.2 STKc_NDR_like 118..485 CDD:270750 107/351 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.