DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12069 and PRKG2

DIOPT Version :9

Sequence 1:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_016863902.1 Gene:PRKG2 / 5593 HGNCID:9416 Length:774 Species:Homo sapiens


Alignment Length:292 Identity:118/292 - (40%)
Similarity:173/292 - (59%) Gaps:11/292 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KFATNTPSPSTGLDDYEIKATLGSGSFGKVQLVRERESGVYYASKQLSKDQIVKTKQVSHVMSEK 96
            :|::::|     ..:.||.||||.|.||:|:||:.:...|.:|.|.:.|..||.|||..||.|||
Human   443 RFSSSSP-----FQNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEK 502

  Fly    97 NVLRSMTFPNTVNLIASYKDFDSLYLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYL 161
            .:|..:..|..|.|..::||...:|::|....||||::..|....|.|..::|..|.|..|.:||
Human   503 RILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYL 567

  Fly   162 HHCSLLYRDLKPENIMMDKNGYLKVTDFGFAKKVET--RTMTLCGTPEYLPPEIIQSKPYGTSVD 224
            |...::||||||||:::|..||||:.|||||||:.:  :|.|.||||||:.||:|.:|.:..|||
Human   568 HRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVD 632

  Fly   225 WWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKICEADYKM--PSYFSGALRHLVDHLLQVDLSKRF 287
            :|:.|:||:|.:.|:.|||  ..|.|..||.|.:...||  |...:.....|:..|.:.:.::|.
Human   633 FWSLGILVYELLTGNPPFS--GVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERL 695

  Fly   288 GNLINGNRDIKEHEWFKDVEWIPLLNQTVNAP 319
            |||.||..|||:|.|.....|..|..:::.:|
Human   696 GNLKNGINDIKKHRWLNGFNWEGLKARSLPSP 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 116/280 (41%)
PKc_like 45..335 CDD:304357 116/279 (42%)
PRKG2XP_016863902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.