DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12069 and PRKACA

DIOPT Version :9

Sequence 1:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001291278.1 Gene:PRKACA / 5566 HGNCID:9380 Length:427 Species:Homo sapiens


Alignment Length:319 Identity:160/319 - (50%)
Similarity:223/319 - (69%) Gaps:5/319 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LDKLREDFNKKFATNTPSPSTG-LDDYEIKATLGSGSFGKVQLVRERESGVYYASKQLSKDQIVK 85
            |.|.:|||.||:  .:|:.:|. ||.:|...|||:||||:|.||:.:|:|.:||.|.|.|.::||
Human    96 LAKAKEDFLKKW--ESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVK 158

  Fly    86 TKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSLYLVLPLIGGGELFTYHRKVRKFTEKQARFY 150
            .||:.|.::||.:|:::.||..|.|..|:||..:||:|:..:.|||:|::.|::.:|:|..||||
Human   159 LKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFY 223

  Fly   151 AAQVFLALEYLHHCSLLYRDLKPENIMMDKNGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQ 215
            |||:.|..||||...|:||||||||:::|:.||::||||||||:|:.||.|||||||||.||||.
Human   224 AAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIIL 288

  Fly   216 SKPYGTSVDWWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKICEADYKMPSYFSGALRHLVDHLLQ 280
            ||.|..:|||||.|||::|..||:.||.|.  ..:.:|.||.....:.||:||..|:.|:.:|||
Human   289 SKGYNKAVDWWALGVLIYEMAAGYPPFFAD--QPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQ 351

  Fly   281 VDLSKRFGNLINGNRDIKEHEWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFDKVSDK 339
            |||:||||||.||..|||.|:||...:||.:..:.|.||::|....|.|.||||...::
Human   352 VDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 151/296 (51%)
PKc_like 45..335 CDD:304357 149/289 (52%)
PRKACANP_001291278.1 STKc_PKA 118..407 CDD:271111 150/290 (52%)
S_TKc 120..374 CDD:214567 135/255 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142885
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S234
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.