DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12069 and Pka-C2

DIOPT Version :9

Sequence 1:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster


Alignment Length:349 Identity:203/349 - (58%)
Similarity:261/349 - (74%) Gaps:0/349 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AQMHFSPKVDYILILDKLREDFNKKFATNTPSPSTGLDDYEIKATLGSGSFGKVQLVRERESGVY 72
            :|..|:.|.||.:|||.:..:|.:::...|.||.|.|::|..:|.||:||||.|.||||:....|
  Fly     6 SQYVFNSKEDYNVILDNMSREFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVMLVREKSGKNY 70

  Fly    73 YASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSLYLVLPLIGGGELFTYHR 137
            ||:|.:||:.:|:.|||:||.:||:||.:..||..:.|:.|.|.||.|||:|||:.|||||:|||
  Fly    71 YAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELFSYHR 135

  Fly   138 KVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDKNGYLKVTDFGFAKKVETRTMTL 202
            :||||.||.||||||||.|||||:|...|:|||||||||::|:.||:|:|||||.|:|:.||.||
  Fly   136 RVRKFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKRVDGRTSTL 200

  Fly   203 CGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKICEADYKMPSYF 267
            |||||||.|||:|.:||..||||||||:||:|||||.|||:.|||||:.||:|||..||||||||
  Fly   201 CGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKICICDYKMPSYF 265

  Fly   268 SGALRHLVDHLLQVDLSKRFGNLINGNRDIKEHEWFKDVEWIPLLNQTVNAPYVPNISNPEDISN 332
            :..||.||:.|:|||.|||.||..:|:.|:|.|.||:.|:|..:|||.|.|||.|.||..||:||
  Fly   266 TSQLRSLVESLMQVDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTISGAEDLSN 330

  Fly   333 FDKVSDKPRPKAKTMRHEEAFADF 356
            |:....|.|.|::..||.|.||:|
  Fly   331 FENFEFKDRYKSRINRHPELFANF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 189/311 (61%)
PKc_like 45..335 CDD:304357 180/289 (62%)
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 180/290 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460717
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Homologene 1 1.000 - - H64790
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S234
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 1 1.000 - - FOG0019794
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.