DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12069 and Pka-C3

DIOPT Version :9

Sequence 1:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_730083.2 Gene:Pka-C3 / 39733 FlyBaseID:FBgn0000489 Length:583 Species:Drosophila melanogaster


Alignment Length:315 Identity:137/315 - (43%)
Similarity:203/315 - (64%) Gaps:4/315 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LDDYEIKATLGSGSFGKVQLVRERESGVYYASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNTV 108
            ||||:|..|:|:|:||:|.|.|:|.|..|.|.|.|:..::::.||:.||.:|:|:||.:..|..:
  Fly   271 LDDYQIIKTVGTGTFGRVCLCRDRISEKYCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVI 335

  Fly   109 NLIASYKDFDSLYLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKP 173
            :|..|.||..:||::...:.|||||||.|...|||.:.:.||||::..||||||...::||||||
  Fly   336 SLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKP 400

  Fly   174 ENIMMDKNGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAG 238
            ||::::::|:||:||||||||:..||.||||||||:.|||||||.:..:|||||.|||::|.:.|
  Fly   401 ENLLINRDGHLKITDFGFAKKLRDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVG 465

  Fly   239 HSPFSAHNRDVMSMYNKICEADYKMPSYFSGALRHLVDHLLQVDLSKRFGNLINGNRDIKEHEWF 303
            :.||  ::.....:|.||.....:...:.....:.|:..||..|.:||.||:.||..|:|.|.||
  Fly   466 YPPF--YDEQPFGIYEKILSGKIEWERHMDPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWF 528

  Fly   304 KDVEWIPLLNQTVNAPYVPNISNPEDISNFDKVSDKP-RP-KAKTMRHEEAFADF 356
            |.:.|..:.::.:..|.:|::.:..|..|||...:|. :| ||...|..:.|.||
  Fly   529 KHLNWNDVYSKKLKPPILPDVHHDGDTKNFDDYPEKDWKPAKAVDQRDLQYFNDF 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 135/313 (43%)
PKc_like 45..335 CDD:304357 127/289 (44%)
Pka-C3NP_730083.2 PTZ00263 262..583 CDD:140289 135/313 (43%)
STKc_PRKX_like 272..563 CDD:270763 128/292 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440852
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.