DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12069 and CG4839

DIOPT Version :9

Sequence 1:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster


Alignment Length:359 Identity:125/359 - (34%)
Similarity:191/359 - (53%) Gaps:47/359 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VDYILILDKLRE-DFNKKFATNTPSPSTGLD---DY------EIK--ATLGSGSFGKVQLVRERE 68
            :.|:..:.:||| ..:::..|:..|.:..|:   :|      |:|  ||||.|:||:|.||...:
  Fly   651 ISYLGTIKQLREKPSSQRNDTSGRSSTKSLEFDNEYSQVAISELKKIATLGCGAFGRVDLVAYNQ 715

  Fly    69 SGVYYASKQLSKDQIVKTKQVSHVMSEKNV-LRSMTFPNTVNLIASYKDFDSLYLVLPLIGGGEL 132
            ..:  |.|.:.|.::||..|:.||.:|||| ::....|..|.|..:|::...:|.::....||::
  Fly   716 QAL--ALKIIKKIEVVKQDQIEHVYNEKNVMIKCRQSPFIVQLYRTYRNDKYVYFLMEACMGGDV 778

  Fly   133 FTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDKNGYLKVTDFGFAKKV-- 195
            :|...|.:.|.||.|:|.|..|..|.:|||....:||||||||:|:..:||.|:.||||||.|  
  Fly   779 WTVMSKRQYFDEKTAKFIAGCVVEAFDYLHSHHFIYRDLKPENLMLGTDGYCKLVDFGFAKFVRQ 843

  Fly   196 ETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKICEA- 259
            ..:|.|..|||||:.||||..:.:..:||:||.|:||:|.:.|.:||...|:  :.:|.:|... 
  Fly   844 NEKTNTFAGTPEYVAPEIILDRGHDRAVDYWALGILVYELLVGKTPFRGVNQ--IKIYQQILSGI 906

  Fly   260 -DYKMPSYFSGALRHLVDHLLQVDLSKRFGNLINGNRDIKEHEWFKDVEW-------------IP 310
             ...|||....:.:|||.||.:...::|.|....|..|||.|.||:.::|             .|
  Fly   907 DVIHMPSRIPKSAQHLVRHLCKQLPAERLGYQRKGIADIKRHSWFESLDWQRLKLKQLPSPIKRP 971

  Fly   311 LLNQT---------VNAPYVPNISNPEDISNFDK 335
            |.:.|         |...|.|    ||::|.:||
  Fly   972 LKSWTDLQYFGPSGVENDYEP----PEELSGWDK 1001

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 119/330 (36%)
PKc_like 45..335 CDD:304357 116/327 (35%)
CG4839NP_609349.1 Crp 428..577 CDD:223736
CAP_ED 431..539 CDD:237999
Crp 544..>650 CDD:223736
CAP_ED 550..663 CDD:237999 3/11 (27%)
S_TKc 695..951 CDD:214567 102/259 (39%)
STKc_cGK 700..957 CDD:270724 101/260 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.