DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12069 and Pkg21D

DIOPT Version :10

Sequence 1:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster


Alignment Length:319 Identity:122/319 - (38%)
Similarity:183/319 - (57%) Gaps:14/319 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DKLREDFNKKFATNTPSPSTGLDDYEIKATLGSGSFGKVQLVR--ERESGVYYASKQLSKDQIVK 85
            |:.:|...::|      |...|.|.|:.:|||.|.||:|:||:  .::....:|.|.|.|..||.
  Fly   439 DEPKEQLQQEF------PDLKLTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIVD 497

  Fly    86 TKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSLYLVLPLIGGGELFTYHRKVRKFTEKQARFY 150
            |||..|:.||::::.|...|....|..:::|...:|::|....|||::|..|....|.:..|:|.
  Fly   498 TKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFI 562

  Fly   151 AAQVFLALEYLHHCSLLYRDLKPENIMMDKNGYLKVTDFGFAKKVET--RTMTLCGTPEYLPPEI 213
            ...|..|.||||...::||||||||:|:|:.||:|:.||||||::.|  :|.|.||||||:.|||
  Fly   563 IGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEI 627

  Fly   214 IQSKPYGTSVDWWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKICEA--DYKMPSYFSGALRHLVD 276
            |.:|.:..:||:||.|:|:.|.:.|..||||  .|.|..||.|.:.  ....|.:.|.....|:.
  Fly   628 ILNKGHDRAVDYWALGILIHELLNGTPPFSA--PDPMQTYNLILKGIDMIAFPKHISRWAVQLIK 690

  Fly   277 HLLQVDLSKRFGNLINGNRDIKEHEWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFDK 335
            .|.:...|:|.|....|.:|||:|:||...:|..|.:|.:..|:|..|::|.|:..||:
  Fly   691 RLCRDVPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYFDR 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12069NP_651819.1 Protein Kinases, catalytic domain 45..335 CDD:473864 116/295 (39%)
Pkg21DNP_477213.1 CAP_ED 185..285 CDD:237999
CAP_ED 304..419 CDD:237999
STKc_cGK 463..724 CDD:270724 105/262 (40%)
S_TK_X 719..>760 CDD:214529 10/31 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.