DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12069 and prkg3

DIOPT Version :9

Sequence 1:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_017208033.2 Gene:prkg3 / 326020 ZFINID:ZDB-GENE-030131-4745 Length:745 Species:Danio rerio


Alignment Length:346 Identity:123/346 - (35%)
Similarity:186/346 - (53%) Gaps:25/346 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLREDFNKKFATNTPS---PSTGLDDYEI-------------KATLGSGSFGKVQLVRERESGVY 72
            :|.:|.|.......|.   |.|.|...::             ..|||.|.||||:||...|...|
Zfish   399 ELHDDANVSEIDEKPEKARPETSLKLKDLVPVLYQEGSYQGDPVTLGIGGFGKVELVTTLEHRKY 463

  Fly    73 YASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSLYLVLPLIGGGELFTYHR 137
            :|.|::||..:|..||.:|::.||.:|:::.....|.|.|::||...:|:::....|||::|..:
Zfish   464 FAMKRISKQHVVAKKQEAHILLEKKILQAIRCDFIVRLHAAFKDSRYVYMIMEFCPGGEIWTKLK 528

  Fly   138 KVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDKNGYLKVTDFGFAKKVE--TRTM 200
            :..:|.||.|.|..|.|..|..|||:..:|||||||||:|:|..||:|:.||||||::.  .:|.
Zfish   529 EAGRFEEKIAVFITACVVEAYAYLHNKGILYRDLKPENLMLDSKGYVKLVDFGFAKELSRGEKTY 593

  Fly   201 TLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKICEADYKMPS 265
            :.||||||:.|||||::.:..:.|:|:.|||::|.:.|..|||  :.:...:|.||.:.....||
Zfish   594 SFCGTPEYISPEIIQNQGHDIAADFWSLGVLIYELLVGSPPFS--SSEPQKIYAKILDGVLNFPS 656

  Fly   266 YFSGALRHLVDHLLQVDLSKRFGNLINGNRDIKEHEWFKDVEWIPLLNQTVNAPYVPNISNPEDI 330
            |.....:.::..|.::...:|.||..||.:|::.|.||..:.|..|....:.||.|..|......
Zfish   657 YMGEGAKSIISKLCRLRPGQRLGNTKNGIKDVRHHRWFNSINWHKLRMGQLEAPTVRLIRKGPCY 721

  Fly   331 SNFDKVSDKPRPKAKTMRHEE 351
            .|||:.     |..||...||
Zfish   722 INFDRF-----PYDKTQAEEE 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 117/323 (36%)
PKc_like 45..335 CDD:304357 110/304 (36%)
prkg3XP_017208033.2 CAP_ED 173..282 CDD:237999
CAP_ED 292..393 CDD:237999
STKc_cGK 444..699 CDD:270724 101/256 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.