DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12069 and prkg2

DIOPT Version :9

Sequence 1:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_021331649.1 Gene:prkg2 / 100125912 ZFINID:ZDB-GENE-060531-80 Length:769 Species:Danio rerio


Alignment Length:340 Identity:128/340 - (37%)
Similarity:185/340 - (54%) Gaps:29/340 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LDKLREDFNKKFATNTPS---PSTGL--DDYEIK------------------ATLGSGSFGKVQL 63
            :|.|..|..|:.|..:.|   |:|.:  |..|:|                  ||||.|.||:|:|
Zfish   412 VDSLARDDKKRNAKRSGSCTPPNTPVSHDMIELKERESSFASTIPFTCLEAIATLGVGGFGRVEL 476

  Fly    64 VRERESGVYYASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSLYLVLPLIG 128
            |:.:...|.:|.|.:.|..||..:|..|:.||:.:|.....|..|.:..:|||...:|::|....
Zfish   477 VKLKNENVTFALKCIKKRHIVDNRQEEHIYSERRILLETNCPFIVKMYRTYKDNKYVYMLLEACL 541

  Fly   129 GGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDKNGYLKVTDFGFAK 193
            |||:::..|....|.|..|:|....|..|.:|||:..::||||||||:|:|.:||:|:.||||||
Zfish   542 GGEIWSLLRDRGSFEEYTAKFCVGCVTEAFDYLHNNGIIYRDLKPENLMLDTDGYVKLVDFGFAK 606

  Fly   194 KVE--TRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKI 256
            |::  .||.|.||||||:.||||.:|.:|.|||:|:.|:|:||.:.|..||:  ..|.|.:|..|
Zfish   607 KLKCGQRTWTFCGTPEYVAPEIILNKGHGLSVDFWSLGILIFELLTGSPPFT--GSDQMIIYTFI 669

  Fly   257 CEADYKM--PSYFSGALRHLVDHLLQVDLSKRFGNLINGNRDIKEHEWFKDVEWIPLLNQTVNAP 319
            .:...||  |...:.....|:..|.:.:.|:|.|||.||..|||:|.||....|..|..:.:.:|
Zfish   670 LKGIEKMDFPKKITKRPGDLIRKLCRQNPSERLGNLKNGITDIKKHRWFTGFSWSGLKARNLISP 734

  Fly   320 YVPNISNPEDISNFD 334
            ....:..|.|.|.||
Zfish   735 LKREVKGPTDHSYFD 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 120/315 (38%)
PKc_like 45..335 CDD:304357 120/312 (38%)
prkg2XP_021331649.1 CAP_ED 176..284 CDD:237999
CAP_ED 293..408 CDD:237999
STKc_cGK 466..725 CDD:270724 108/260 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.