DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn100A and Serpinb9b

DIOPT Version :10

Sequence 1:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001333297.1 Gene:Serpinb9b / 306892 RGDID:1562844 Length:296 Species:Rattus norvegicus


Alignment Length:188 Identity:51/188 - (27%)
Similarity:99/188 - (52%) Gaps:9/188 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 SAGSKSKMLLFNGLYYRGSWANPFYQLRDGSD-EFFFMTNEDAVK-APMMHARGKFQVADLPQVK 455
            |...:::::|.|.||.:.:|..   |..:||. |..|..|::..: ..||:..|.|....:.:|.
  Rat   102 SVDFQTRLVLVNALYLKATWGR---QFDEGSTREMPFKINKNETRPVQMMYQEGIFCYKYVKEVP 163

  Fly   456 ARVLSLPYETSRYALCIVLPDETEGLSDVISQLQTSDFLLAKKQ---FQMKELHISMPKFQVEET 517
            |.:|.:||:.......::||||:..:|.|..:| |.:.|.|..|   .....:.:.:|||::||.
  Rat   164 ASLLMIPYKGDELCFLVLLPDESVDISKVEEEL-TFEKLTAWTQPDTMSYTHVEVFLPKFKLEED 227

  Fly   518 SRSEAMLKQMGLKKVFSRTEAQLSLLSEDPDVHVDEIVQFVNVRVDEGGSSANSLSAA 575
            ...:::|:::|:...|..|:|.||.::.:.::.|.:.|....|.|:|.|:.|.:.:::
  Rat   228 YDLKSLLQRLGIVDAFEETKADLSAMAPERNLCVSKFVHKSVVEVNEKGTEAAAAASS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn100ANP_651818.1 serpin 41..>146 CDD:476815
serpin <380..627 CDD:381000 51/188 (27%)
Serpinb9bNP_001333297.1 serpin 7..293 CDD:476815 51/188 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.