DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaPV and AT5G18900

DIOPT Version :9

Sequence 1:NP_733395.1 Gene:PH4alphaPV / 43640 FlyBaseID:FBgn0051015 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 / 832008 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana


Alignment Length:221 Identity:68/221 - (30%)
Similarity:107/221 - (48%) Gaps:25/221 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 TSPFLILAPLKMELVGLDPYMVLYHDVLSPKEIKELQGMATPGLKRATVYQASSGRNEVVKTRTS 375
            :|..:.:.|.|::.|...|...:|...|:..|...:..:|...|||:.|....||.::..:.|||
plant    26 SSSSVFVNPSKVKQVSSKPRAFVYEGFLTELECDHMVSLAKASLKRSAVADNDSGESKFSEVRTS 90

  Fly   376 KVAWFPDGYNPLTVRLNARISDMTGFNLYGSEMLQLMNYGLGGHYDQHYDFF-NKTNSNMTAMSG 439
            ...:...|.:|:...:..:||..|.......|.:|::.|..|..||.|:|:| :|.|   ....|
plant    91 SGTFISKGKDPIVSGIEDKISTWTFLPKENGEDIQVLRYEHGQKYDAHFDYFHDKVN---IVRGG 152

  Fly   440 DRIATVLFYLTDVEQGGATVFPNI----RK-----------------AVFPQRGSVVMWYNLKDN 483
            .|:||:|.||::|.:||.||||:.    |:                 ||.|::|..::::||..:
plant   153 HRMATILMYLSNVTKGGETVFPDAEIPSRRVLSENKEDLSDCAKRGIAVKPRKGDALLFFNLHPD 217

  Fly   484 GQIDTQTLHAACPVIVGSKWVCNKWI 509
            ...|..:||..||||.|.||...|||
plant   218 AIPDPLSLHGGCPVIEGEKWSATKWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaPVNP_733395.1 P4Ha_N 35..164 CDD:285528
TPR_11 179..250 CDD:290150
TPR repeat 179..213 CDD:276809
TPR repeat 218..248 CDD:276809
P4Hc 339..510 CDD:214780 61/193 (32%)
AT5G18900NP_197391.1 PLN00052 33..298 CDD:177683 67/214 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.