DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaPV and AT4G35820

DIOPT Version :9

Sequence 1:NP_733395.1 Gene:PH4alphaPV / 43640 FlyBaseID:FBgn0051015 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:296 Identity:73/296 - (24%)
Similarity:125/296 - (42%) Gaps:74/296 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 TLLKLNQHADALKVVNIALTDNPHDIKLLLKKSEIETMIRT-----GTNNAPPVKVQATGVPTAY 287
            |:|.|.|....||:               .:.|::...|.|     |...:..||::        
plant     9 TILYLRQRLQGLKI---------------YETSDLIQHINTFDELVGEQVSVDVKIE-------- 50

  Fly   288 QIGCRGQFPPSADSKLYC-----LYNRTTSPFLILAPLK------MELVGLDPYMVLYHDVL--- 338
                    ..:.|..|.|     |...|.|...:.|.|:      :|::..:|...:||:.|   
plant    51 --------EKTKDMILLCSLSPLLTTLTCSMVKVAASLRFPNERWLEVITKEPRAFVYHNFLALF 107

  Fly   339 -----SPKEIKELQGMATPGLKRATVYQASSGRNEVVKTRTSKVAWFPDGYNPLTVRLNARISDM 398
                 :.:|...|..:|.|.:.|:.|..|.:|..|...:|||...:...|::.:...:..|||:.
plant   108 FKICKTNEECDHLISLAKPSMARSKVRNALTGLGEESSSRTSSGTFIRSGHDKIVKEIEKRISEF 172

  Fly   399 TGFNLYGSEMLQLMNYGLGGHYDQHYDFFNKTNSNMTAMSGDRIATVLFYLTDVEQGGATVFPNI 463
            |.......|.||::||.:|..::.|:|.|            .||||||.||:||::||.||||..
plant   173 TFIPQENGETLQVINYEVGQKFEPHFDGF------------QRIATVLMYLSDVDKGGETVFPEA 225

  Fly   464 R-------KAVFPQRGSVVMWYNLKDNGQIDTQTLH 492
            :       .:|.|::|..:::::::.:|..|..:.|
plant   226 KGIKSKKGVSVRPKKGDALLFWSMRPDGSRDPSSKH 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaPVNP_733395.1 P4Ha_N 35..164 CDD:285528
TPR_11 179..250 CDD:290150 6/21 (29%)
TPR repeat 179..213 CDD:276809
TPR repeat 218..248 CDD:276809 6/19 (32%)
P4Hc 339..510 CDD:214780 48/161 (30%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 18/98 (18%)
P4Hc 115..262 CDD:214780 48/159 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.