DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaPV and AT4G33910

DIOPT Version :9

Sequence 1:NP_733395.1 Gene:PH4alphaPV / 43640 FlyBaseID:FBgn0051015 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 / 829535 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana


Alignment Length:219 Identity:69/219 - (31%)
Similarity:101/219 - (46%) Gaps:30/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 ELVGLDPYMVL--------YHDVLSPKEIKELQGMATPGLKRATVYQASSGRNEVVK-TRTSKVA 378
            |.:|..|:.||        :.:..:.::.:.:...|...||.:.:........|..| ||||. .
plant    71 ESIGSIPFQVLSWRPRAIYFPNFATAEQCQAIIERAKVNLKPSALALRKGETAENTKGTRTSS-G 134

  Fly   379 WFPDGYNPLTVRLN---ARISDMTGFNLYGSEMLQLMNYGLGGHYDQHYDFFNKTNSNMTAMSGD 440
            .|.......|..|:   .:|:..|.......|...::.|.||..||.|||.||.|...  ..|..
plant   135 TFISASEESTGALDFVERKIARATMIPRSHGESFNILRYELGQKYDSHYDVFNPTEYG--PQSSQ 197

  Fly   441 RIATVLFYLTDVEQGGATVFP---------------NIRKAVFPQRGSVVMWYNLKDNGQIDTQT 490
            |||:.|.||:|||:||.|:||               .|...|.|::|..:::|::..||.||..:
plant   198 RIASFLLYLSDVEEGGETMFPFENGSNMGIGYDYKQCIGLKVKPRKGDGLLFYSVFPNGTIDQTS 262

  Fly   491 LHAACPVIVGSKWVCNKWIREREQ 514
            ||.:|||..|.|||..||||:::|
plant   263 LHGSCPVTKGEKWVATKWIRDQDQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaPVNP_733395.1 P4Ha_N 35..164 CDD:285528
TPR_11 179..250 CDD:290150
TPR repeat 179..213 CDD:276809
TPR repeat 218..248 CDD:276809
P4Hc 339..510 CDD:214780 61/189 (32%)
AT4G33910NP_567941.1 PLN00052 66..287 CDD:177683 69/219 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.