DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaPV and P4H5

DIOPT Version :9

Sequence 1:NP_733395.1 Gene:PH4alphaPV / 43640 FlyBaseID:FBgn0051015 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:212 Identity:67/212 - (31%)
Similarity:114/212 - (53%) Gaps:23/212 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 MELVGLDPYMVLYHDVLSPKEIKELQGMATPGLKRATVYQASSGRNEVVKTRTSKVAWFPDGYNP 386
            :|::..:|..|:||:.|:.:|.:.|..:|.|.:.::||....:|.::..:.|||...:...|::.
plant    80 VEVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSKDSRVRTSSGTFLRRGHDE 144

  Fly   387 LTVRLNARISDMTGFNLYGSEMLQLMNYGLGGHYDQHYDFF-NKTNSNMTAMSGDRIATVLFYLT 450
            :...:..||||.|...:...|.||:::|.:|..|:.|||:| ::.|   |...|.||||||.||:
plant   145 VVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFN---TKNGGQRIATVLMYLS 206

  Fly   451 DVEQGGATVFPNIR-------------------KAVFPQRGSVVMWYNLKDNGQIDTQTLHAACP 496
            ||:.||.||||..|                   .:|.|::...::::|::.:..:|..:||..||
plant   207 DVDDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLDPSSLHGGCP 271

  Fly   497 VIVGSKWVCNKWIRERE 513
            |:.|:||...||....|
plant   272 VVKGNKWSSTKWFHVHE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaPVNP_733395.1 P4Ha_N 35..164 CDD:285528
TPR_11 179..250 CDD:290150
TPR repeat 179..213 CDD:276809
TPR repeat 218..248 CDD:276809
P4Hc 339..510 CDD:214780 60/190 (32%)
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 67/212 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 1 0.900 - - OOG6_100878
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.