DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaPV and P4HTM

DIOPT Version :9

Sequence 1:NP_733395.1 Gene:PH4alphaPV / 43640 FlyBaseID:FBgn0051015 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM / 54681 HGNCID:28858 Length:563 Species:Homo sapiens


Alignment Length:567 Identity:110/567 - (19%)
Similarity:167/567 - (29%) Gaps:240/567 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 YLSNPLNSFSLIRRMNRDWIIWQLYMDDPVGISQVERIQELREHMPTHTDVEEAVTALDRIQSTY 152
            ||.|.|.....:...|.|      ...||.           .:|.......|..:..|.|::   
Human    71 YLGNVLALLLFVHYSNGD------ESSDPG-----------PQHRAQGPGPEPTLGPLTRLE--- 115

  Fly   153 GLKVPEISHGFLNGKQYNVSLTV-----LDTYAMGQILFDQKNYLAAASWIYQSVVLMEAFSMAA 212
            |:||         |.:..|.|..     :.|.::..:||:...:|.               ....
Human   116 GIKV---------GHERKVQLVTDRDHFIRTLSLKPLLFEIPGFLT---------------DEEC 156

  Fly   213 PLEISKNEVRMVYAETLLKLNQHADALKVVNIA------LTDNPHDIKLLLKKSEIETMIRTGTN 271
            .|.|...:::.:....:|...::.:|:..:.::      |.|...|..|.|::...:|.:..|  
Human   157 RLIIHLAQMKGLQRSQILPTEEYEEAMSTMQVSQLDLFRLLDQNRDGHLQLREVLAQTRLGNG-- 219

  Fly   272 NAPPVKVQATGVPTAYQIGCRGQFPPSADSKLYCLYNRTTSPFLILAPLKMELVGLDPYMVLYHD 336
                                 ....|.:..::|             |.:|.:..|        ..
Human   220 ---------------------WWMTPESIQEMY-------------AAIKADPDG--------DG 242

  Fly   337 VLSPKEIKELQGMATPGLKRATVYQASSGRNEVVKTRTSKVAWFPDGYNP-------------LT 388
            |||      ||..:...|:....|..|.........|.|...|...|...             ||
Human   243 VLS------LQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLT 301

  Fly   389 VRLNARISDMTGFNLYGSEMLQLMNYGLGGHYDQHYD---FFNKTNSNMTAM------------- 437
             ||:..|.::       ||.||::.||.||||..|.|   .:.:|..:.|.:             
Human   302 -RLSPEIVEL-------SEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCR 358

  Fly   438 ---------------------------------SGDR------------------------IATV 445
                                             .||.                        ..||
Human   359 QVSPNWGLPSILRPGTPMTQAQPCTVGVPLGMGPGDHWVIPVSPWEHPQLGTCSVPPLPYSYMTV 423

  Fly   446 LFYLTDVEQGGATVFP-----------------------------NIRKAVFPQRGSVVMWYNLK 481
            ||||.:|..||.||||                             |:|  |.||:|:.|.|||..
Human   424 LFYLNNVTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLR--VKPQQGTAVFWYNYL 486

  Fly   482 DNGQ-----IDTQTLHAACPVIVGSKWVCNKWI-----REREQIFSR 518
            .:||     :|..:||..|.|..|:||:.|.||     |.|:.:|.:
Human   487 PDGQGWVGDVDDYSLHGGCLVTRGTKWIANNWINVDPSRARQALFQQ 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaPVNP_733395.1 P4Ha_N 35..164 CDD:285528 15/75 (20%)
TPR_11 179..250 CDD:290150 9/76 (12%)
TPR repeat 179..213 CDD:276809 3/33 (9%)
TPR repeat 218..248 CDD:276809 3/35 (9%)
P4Hc 339..510 CDD:214780 67/295 (23%)
P4HTMNP_808807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111 4/32 (13%)
EF-hand_7 192..252 CDD:290234 17/109 (16%)
EFh 194..252 CDD:238008 17/107 (16%)
P4Hc 246..519 CDD:214780 64/282 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149305
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.