DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaPV and phy-3

DIOPT Version :9

Sequence 1:NP_733395.1 Gene:PH4alphaPV / 43640 FlyBaseID:FBgn0051015 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_507251.2 Gene:phy-3 / 188624 WormBaseID:WBGene00004026 Length:318 Species:Caenorhabditis elegans


Alignment Length:233 Identity:60/233 - (25%)
Similarity:102/233 - (43%) Gaps:52/233 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 LYNRTTSPFLILAPLKMELVGLDPYMVLYHDVLSPKEIK-----------ELQGMATPGLKRATV 359
            :||        :.|:.||::...|.:|:|.:::||::..           |:|..:..|....|.
 Worm    77 VYN--------MLPVDMEIISWAPTLVIYRNLMSPRQTASFLNFIEQRDLEIQKTSDFGTSIETT 133

  Fly   360 YQASSGRNEVVKTRTSKVAWFPDGYNPLTVRLNARISD-MTGFNLYGSEMLQLMNYGLGGHYDQH 423
            ::.::|            ::.|...:.:||.:..:... :.|.||..:|....::|..||||..|
 Worm   134 HRRANG------------SFIPPEDSNVTVEIKMQAQKRIPGLNLTVAEHFSALSYLPGGHYAVH 186

  Fly   424 YDF------------FNKTNSNMTAMSGDRIATVLFYLTDVEQGGATVFPNIRKAVFPQRGSVVM 476
            ||:            .|||        |:||.|::|.|...|:||.||||:|...|....|....
 Worm   187 YDYLDYRSKQDYDWWMNKT--------GNRIGTLIFVLKPAEKGGGTVFPSIGSTVRANAGDAFF 243

  Fly   477 WYNLKDNGQIDTQTLHAACPVIVGSKWVCNKWIREREQ 514
            |:|.:.:.:.:..:.|..||:..|.|.:...|||...|
 Worm   244 WFNAQADEEKEMLSNHGGCPIYEGRKVIATIWIRAYNQ 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaPVNP_733395.1 P4Ha_N 35..164 CDD:285528
TPR_11 179..250 CDD:290150
TPR repeat 179..213 CDD:276809
TPR repeat 218..248 CDD:276809
P4Hc 339..510 CDD:214780 49/194 (25%)
phy-3NP_507251.2 P4Hc 102..277 CDD:214780 49/194 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3137
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.720

Return to query results.
Submit another query.