Sequence 1: | NP_733395.1 | Gene: | PH4alphaPV / 43640 | FlyBaseID: | FBgn0051015 | Length: | 525 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001359861.1 | Gene: | C14E2.4 / 182616 | WormBaseID: | WBGene00015773 | Length: | 311 | Species: | Caenorhabditis elegans |
Alignment Length: | 233 | Identity: | 57/233 - (24%) |
---|---|---|---|
Similarity: | 92/233 - (39%) | Gaps: | 65/233 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 320 LKMELVGLDPYMVLYHDVLSPKEI-----------------------------KELQGMATPGLK 355
Fly 356 RATVYQASSGRNEVVKTRTSKVAWFPDGYNPLTVRLNARISDMTGFNLYGSEMLQLMNYGLGGHY 420
Fly 421 DQHYDFF---NKTNSNM-TAMSGDRIATVLFYLTDVEQGGATVFPNIRKAVFPQRGSVVMWYNLK 481
Fly 482 DNGQIDTQTLHAACPVIVGSKWVCNKWIREREQIFSRP 519 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PH4alphaPV | NP_733395.1 | P4Ha_N | 35..164 | CDD:285528 | |
TPR_11 | 179..250 | CDD:290150 | |||
TPR repeat | 179..213 | CDD:276809 | |||
TPR repeat | 218..248 | CDD:276809 | |||
P4Hc | 339..510 | CDD:214780 | 45/203 (22%) | ||
C14E2.4 | NP_001359861.1 | P4Hc | 100..276 | CDD:214780 | 45/203 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1591 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3137 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
4 | 3.720 |