DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaPV and LOC110438249

DIOPT Version :9

Sequence 1:NP_733395.1 Gene:PH4alphaPV / 43640 FlyBaseID:FBgn0051015 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_021324927.1 Gene:LOC110438249 / 110438249 -ID:- Length:229 Species:Danio rerio


Alignment Length:224 Identity:105/224 - (46%)
Similarity:139/224 - (62%) Gaps:3/224 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 PSADSKLYCLYNRTTSPFLILAPLKMELVGLDPYMVLYHDVLSPKEIKELQGMATPGLKRATVYQ 361
            |..:.||.|.|.|.....|:|  .|.|:....|.::.|||.||..||..::.:|.|.|.||.|..
Zfish     3 PQRERKLVCRYRRGRGNPLML--FKEEVEWDQPMILRYHDFLSEGEIDTIKTLARPKLSRAQVID 65

  Fly   362 ASSGRNEVVKTRTSKVAWFPDGYNPLTVRLNARISDMTGFNLYGSEMLQLMNYGLGGHYDQHYDF 426
            |.||:.....:|.|:.||..:..:|:..::|.||:|:||..|..:|.||:.|||:||.|:.||| 
Zfish    66 AVSGKRVSAASRVSQSAWLYEDEDPVVTQVNQRIADVTGLELQTAESLQIANYGIGGQYEPHYD- 129

  Fly   427 FNKTNSNMTAMSGDRIATVLFYLTDVEQGGATVFPNIRKAVFPQRGSVVMWYNLKDNGQIDTQTL 491
            ...||.:...:.|.||||||.|::||:.|||||||::..|:.|:|||.|:|:||..||..|.:||
Zfish   130 SKLTNDSDFQLRGGRIATVLIYMSDVDIGGATVFPDVGAALQPKRGSAVLWFNLLRNGNEDIRTL 194

  Fly   492 HAACPVIVGSKWVCNKWIREREQIFSRPC 520
            ||||||.||||||.|||||...|.|.|.|
Zfish   195 HAACPVFVGSKWVANKWIRTYGQEFRRKC 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaPVNP_733395.1 P4Ha_N 35..164 CDD:285528
TPR_11 179..250 CDD:290150
TPR repeat 179..213 CDD:276809
TPR repeat 218..248 CDD:276809
P4Hc 339..510 CDD:214780 84/170 (49%)
LOC110438249XP_021324927.1 PLN00052 28..218 CDD:177683 91/190 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.