DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and P4HA2

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001136071.1 Gene:P4HA2 / 8974 HGNCID:8547 Length:535 Species:Homo sapiens


Alignment Length:502 Identity:127/502 - (25%)
Similarity:212/502 - (42%) Gaps:72/502 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNLERNLLQNMRDYAEKLEEKIDLINNYVEDYNVDIEDANEDPEKYLSNPLNSFRLIRHMHQDW 65
            ::..|:.|:|::::|....|.|:..|.::..........:..|.|.||::|:|:::|::.::.||
Human    33 LIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTDW 97

  Fly    66 VGWQVYMEDLVAPE-AVQKVESLLPQ---LPQKEAFRKAARSVHSLTQFYGYEPADLVAKDERSS 126
            ..    :||||..: |...:.:|..|   .|..|....||:::..|...|..:|. .:::.|...
Human    98 PA----LEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQDTYRLDPG-TISRGELPG 157

  Fly   127 SLH---LSPLDCYHLGLELYEEQDYLGAAKWL-----QVAAHNYTLSRHRDLFNPLGAPRWQVYR 183
            :.:   ||..||:.:|...|.|.||.....|:     |:.|.....:....:.:.|....:|: .
Human   158 TKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQL-G 221

  Fly   184 DLGRTLLKLNRQCAYD-AYESA---LR-----LNSQNVHLMKEAGQMELFSLRDPMEPILDLQPK 239
            ||.|.|....|..:.| ::|.|   ||     |..:....:....:.||.:.....|..:|..|:
Human   222 DLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPE 286

  Fly   240 PTVLEKYCRGE----VPRHQGRLTCELNDWVHS----FLAYAPIKFEDLQQDPFIILYPGSIYEQ 296
            ..|.|..||||    .||.|.||.|..:   |.    .|..||.|.||....|.|:.|...:.::
Human   287 RDVYESLCRGEGVKLTPRRQKRLFCRYH---HGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDE 348

  Fly   297 EIRHVENAYE----RCPPNDRFELKLGISGCSIS------DGYSPVLKRINERILDMAGVE-KTW 350
            ||..::...:    |....|.....|.::...:|      :...||:.|:|.|:..:.|:. ||.
Human   349 EIERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTA 413

  Fly   351 DTFYIVEYAQLAPFEP-FKLFRNSTK--FPKLNLMNFEDVEAKVIIFL---KDVTLGGAFTMPNG 409
            :...:..|.....:|| |...||..:  |..|...|      :|..||   .||..|||...|:.
Human   414 ELLQVANYGVGGQYEPHFDFSRNDERDTFKHLGTGN------RVATFLNYMSDVEAGGATVFPDL 472

  Fly   410 DILVQPKRG------NVLITFENE---EHSTTICPIIEGTGLVMIKF 447
            ...:.||:|      |:|.:.|.:   .|:.  ||::.|...|..|:
Human   473 GAAIWPKKGTAVFWYNLLRSGEGDYRTRHAA--CPVLVGCKWVSNKW 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528 30/121 (25%)
P4HA2NP_001136071.1 P4Ha_N 26..155 CDD:311993 30/126 (24%)
TPR 207..240 8/33 (24%)
P4Hc 346..519 CDD:214780 44/180 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391515at2759
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.