DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and AT1G20270

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:257 Identity:49/257 - (19%)
Similarity:92/257 - (35%) Gaps:64/257 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LFSLRDPMEPILDLQPKPTVLEKYCRGEVPRHQG------RLTCELNDW------VHSFLAYAPI 275
            :|||     ||.:.:..|..|..:.|....|.:|      :.| |:..|      .|:||:....
plant    39 VFSL-----PINNDESSPIDLSYFRRAATERSEGLGKRGDQWT-EVLSWEPRAFVYHNFLSKEEC 97

  Fly   276 KFEDLQQDPFIILYPGSIYEQEIRHVENAYERCPPNDRFELKLGISGCSISDGYSPVLKRINERI 340
            ::......|.::  ..::.:.|....:::..|..           ||..:..|...::|.|.:||
plant    98 EYLISLAKPHMV--KSTVVDSETGKSKDSRVRTS-----------SGTFLRRGRDKIIKTIEKRI 149

  Fly   341 LDMAGVEKT-WDTFYIVEYAQLAPFEP-FKLFRNSTKFPKLNLMNFEDVEAKVIIFLKDVTLGGA 403
            .|...:... .:...::.|.....:|| :..|     ..:.|..|.....|.::::|.||..||.
plant   150 ADYTFIPADHGEGLQVLHYEAGQKYEPHYDYF-----VDEFNTKNGGQRMATMLMYLSDVEEGGE 209

  Fly   404 FTMPNGD-------------------ILVQPKRGNVLITFENEEHSTTI-------CPIIEG 439
            ...|..:                   :.|:|:.|:.|:.:.....:|..       ||:|.|
plant   210 TVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGGCPVIRG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 37/211 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
44.010

Return to query results.
Submit another query.