DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and AT4G35820

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:298 Identity:63/298 - (21%)
Similarity:108/298 - (36%) Gaps:85/298 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 GLELYEEQDYLGAAKWLQVAAHNYTLSRHRDLFNPLGAPRWQVYRDLGRTLLKLNRQCAYDAYES 203
            ||::||..|                |.:|.:.|:.|...:..|...:......:...|:....  
plant    19 GLKIYETSD----------------LIQHINTFDELVGEQVSVDVKIEEKTKDMILLCSLSPL-- 65

  Fly   204 ALRLNSQNVHLMKEAGQMELFSLRDPMEPILDLQPKPTVLEKYCRGEVPRHQGRLTCELNDWVHS 268
               |.:....::|.|.     |||.|.|..|:      |:.|..|..|              .|:
plant    66 ---LTTLTCSMVKVAA-----SLRFPNERWLE------VITKEPRAFV--------------YHN 102

  Fly   269 FLA-YAPIKFEDLQQDPFIILYPGSIYEQEIRHV-----ENAYERCPPNDRFELKLGISGCSISD 327
            ||| :..|...:.:.|..|.|...|:...::|:.     |.:..|..           ||..|..
plant   103 FLALFFKICKTNEECDHLISLAKPSMARSKVRNALTGLGEESSSRTS-----------SGTFIRS 156

  Fly   328 GYSPVLKRINERILDMAGV-EKTWDTFYIVEYAQLAPFEPFKLFRNSTKFPKLNLMNFEDVEAKV 391
            |:..::|.|.:||.:...: ::..:|..::.|.....|||             :...|:.: |.|
plant   157 GHDKIVKEIEKRISEFTFIPQENGETLQVINYEVGQKFEP-------------HFDGFQRI-ATV 207

  Fly   392 IIFLKDVTLGGAFTMPNG-------DILVQPKRGNVLI 422
            :::|.||..||....|..       .:.|:||:|:.|:
plant   208 LMYLSDVDKGGETVFPEAKGIKSKKGVSVRPKKGDALL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 13/78 (17%)
P4Hc 115..262 CDD:214780 34/156 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
44.010

Return to query results.
Submit another query.