DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and AT4G35810

DIOPT Version :10

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_195306.2 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:261 Identity:48/261 - (18%)
Similarity:92/261 - (35%) Gaps:68/261 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LFSLRD-------PMEPILDLQPKPTVLEKYCRGEVPRHQGRLTCELNDWVHSFLAYAPIKFEDL 280
            :|||..       ||:....:|   |:.|:...|:.....|....|:..|               
plant    39 IFSLPSTNKTSSMPMDLTTIVQ---TIQERESFGDEEDGNGDRWLEVISW--------------- 85

  Fly   281 QQDPFIILYPGSIYEQEIRH-VENAYERCPPNDRFELKLG---------ISGCSISDGYSPVLKR 335
              :|...:|...:..:|..| :..|......:...::|.|         .||..::.|:..:::.
plant    86 --EPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTGKSIDSRVRTSSGTFLNRGHDEIVEE 148

  Fly   336 INERILDMAGV-EKTWDTFYIVEYAQLAPFEPFKLFRNSTKFPKLNLMNFEDVEAKVIIFLKDVT 399
            |..||.|...: .:..:...::.|.....:||    .:...|.:.|:.......|.|:::|.||.
plant   149 IENRISDFTFIPPENGEGLQVLHYEVGQRYEP----HHDYFFDEFNVRKGGQRIATVLMYLSDVD 209

  Fly   400 LGGAFTMP--NGDI-----------------LVQPKRGNVLITFENEEHSTTI-------CPIIE 438
            .||....|  .|::                 .|.||:.:.|:.:..:..::..       ||:|:
plant   210 EGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPSSLHGGCPVIK 274

  Fly   439 G 439
            |
plant   275 G 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:462433
AT4G35810NP_195306.2 PLN00052 75..289 CDD:177683 39/222 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.