DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and AT4G33910

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 / 829535 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana


Alignment Length:254 Identity:56/254 - (22%)
Similarity:94/254 - (37%) Gaps:58/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 VPRHQGRLTCELNDWVH------SFLAYAPIKFEDLQQDPFIIL--YPGSIY-------EQEIRH 300
            |||.:.||  .:.|.|.      |.:.:.....|.:...||.:|  .|.:||       ||....
plant    40 VPRVKPRL--RMLDMVENGEEEASSMPHGVTGEESIGSIPFQVLSWRPRAIYFPNFATAEQCQAI 102

  Fly   301 VENAYERCPPNDRFELKLG-----------ISG--CSISDGYSPVLKRINERILDMAGVEKT-WD 351
            :|.|.....|: ...|:.|           .||  .|.|:..:..|..:..:|.....:.:: .:
plant   103 IERAKVNLKPS-ALALRKGETAENTKGTRTSSGTFISASEESTGALDFVERKIARATMIPRSHGE 166

  Fly   352 TFYIVEYAQLAPFEPFKLFRNSTKFPKLNLMNFEDVEAKVIIFLKDVTLGG--AFTMPNGD---- 410
            :|.|:.|.....::......|.|::...:....    |..:::|.||..||  .|...||.    
plant   167 SFNILRYELGQKYDSHYDVFNPTEYGPQSSQRI----ASFLLYLSDVEEGGETMFPFENGSNMGI 227

  Fly   411 ---------ILVQPKRGNVLI---TFENEEHSTT----ICPIIEGTGLVMIKFIMKTDE 453
                     :.|:|::|:.|:   .|.|.....|    .||:.:|...|..|:|...|:
plant   228 GYDYKQCIGLKVKPRKGDGLLFYSVFPNGTIDQTSLHGSCPVTKGEKWVATKWIRDQDQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528
AT4G33910NP_567941.1 PLN00052 66..287 CDD:177683 48/226 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
44.010

Return to query results.
Submit another query.