DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and AT3G28490

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:211 Identity:42/211 - (19%)
Similarity:74/211 - (35%) Gaps:57/211 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 PIKFEDLQQDPFIILYPGSIYEQEIRHVENAYERCPPNDRFELKLGISGCSISDGYSP------- 331
            |.:...|...|...||.|.:.::|..|:...       .:.:|:..:....:..|.|.       
plant    29 PTRITQLSWTPRAFLYKGFLSDEECDHLIKL-------AKGKLEKSMVVADVDSGESEDSEVRTS 86

  Fly   332 ----VLKRINERILDMAGVEKTW--------DTFYIVEYAQLAPFEP-FKLFRNSTKFPKLNLMN 383
                :.||.::.:.::......|        :...|:.|.....::| |..|     :.|..|..
plant    87 SGMFLTKRQDDIVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYF-----YDKKALEL 146

  Fly   384 FEDVEAKVIIFLKDVTLGGAFTMPN------------------GDILVQPKRGNVLITFENEEHS 430
            .....|.|:::|.:||.||....||                  ....|:|::|:.|:.|....:.
plant   147 GGHRIATVLMYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFFNLHLNG 211

  Fly   431 TT-------ICPIIEG 439
            ||       .||:|||
plant   212 TTDPNSLHGSCPVIEG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 42/211 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
44.010

Return to query results.
Submit another query.