DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and P4H2

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:222 Identity:49/222 - (22%)
Similarity:83/222 - (37%) Gaps:59/222 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 PIKFEDLQQDPFIILYPGSIYEQEIRHV-----ENAYERC-PPNDRFELKLG----ISGCSISDG 328
            |.|.:.:...|...:|.|.:.:.|..|:     ||..... ..||..|.::.    .||..||.|
plant    35 PSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRSAVADNDNGESQVSDVRTSSGTFISKG 99

  Fly   329 YSPVLKRINERILDMAGVEKTW--------DTFYIVEYAQLAPFEP-FKLFRNSTKFPKLNLMNF 384
            ..|::..|.:::       .||        :...::.|.....::. |..|.:     |:|:...
plant   100 KDPIVSGIEDKL-------STWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHD-----KVNIARG 152

  Fly   385 EDVEAKVIIFLKDVTLGGAFTMPNGD---------------------ILVQPKRGNVLITFENEE 428
            ....|.|:::|.:||.||....|:..                     |.|:||:||.|:.|..::
plant   153 GHRIATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFNLQQ 217

  Fly   429 HSTTI-------CPIIEGTGLVMIKFI 448
            .:...       ||:|||......|:|
plant   218 DAIPDPFSLHGGCPVIEGEKWSATKWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 44/202 (22%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
44.010

Return to query results.
Submit another query.