DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and P4H13

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:238 Identity:52/238 - (21%)
Similarity:92/238 - (38%) Gaps:50/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 EVPRHQGRLTCELNDWVHSFLAYAPIKFEDLQQDPFIILYPGSIYEQEIRHV-ENAYERCPPNDR 313
            |:|..:..:..|.:...|. .:.:.|.|..|..:|.:...|....:|:...| :.|..:..|: .
plant    42 EIPTTRRSVNDETDSLDHG-SSVSNIPFHGLSWNPRVFYLPNFATKQQCEAVIDMAKPKLKPS-T 104

  Fly   314 FELKLGISGCSISDGY-----------SPVLKRINERILDMAGVEKT-WDTFYIVEYAQLAPFEP 366
            ..|:.| .....:..|           |.||..|.|:|.......|. :::|.|:.|.....::.
plant   105 LALRKG-ETAETTQNYRSLHQHTDEDESGVLAAIEEKIALATRFPKDYYESFNILRYQLGQKYDS 168

  Fly   367 -FKLFRNSTKFPKLN--LMNFEDVEAKVIIFLKDVTLGGAFTMP-------NG--------DILV 413
             :..|.::...|.::  ::.|       ::||..|..||....|       ||        .:.|
plant   169 HYDAFHSAEYGPLISQRVVTF-------LLFLSSVEEGGETMFPFENGRNMNGRYDYEKCVGLKV 226

  Fly   414 QPKRGNVLITFENEEHSTTI--------CPIIEGTGLVMIKFI 448
            :|::|:. |.|.|...:.||        ||:|:|...|..|:|
plant   227 KPRQGDA-IFFYNLFPNGTIDQTSLHGSCPVIKGEKWVATKWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 43/194 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
44.010

Return to query results.
Submit another query.