DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31021 and P4H5

DIOPT Version :9

Sequence 1:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:201 Identity:41/201 - (20%)
Similarity:75/201 - (37%) Gaps:45/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 EDLQQDPFIILYPGSIYEQEIRH-VENAYERCPPNDRFELKLG---------ISGCSISDGYSPV 332
            |.:..:|..::|...:..:|..| :..|......:...:.|.|         .||..:..|:..|
plant    81 EVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSKDSRVRTSSGTFLRRGHDEV 145

  Fly   333 LKRINERILDMAGVE-KTWDTFYIVEYAQLAPFEP-FKLFRNSTKFPKLNLMNFEDVEAKVIIFL 395
            ::.|.:||.|...:. :..:...::.|.....:|| :..|     ..:.|..|.....|.|:::|
plant   146 VEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYF-----LDEFNTKNGGQRIATVLMYL 205

  Fly   396 KDVTLGGAFTMP--NGDI-----------------LVQPKRGNVLITFENEEHSTTI-------- 433
            .||..||....|  .|:|                 .|.||:.:.|: |.|.....::        
plant   206 SDVDDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALL-FWNMRPDASLDPSSLHGG 269

  Fly   434 CPIIEG 439
            ||:::|
plant   270 CPVVKG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 41/201 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
44.010

Return to query results.
Submit another query.